What is the catalog number for AKR1A1 Peptide - middle region?

The catalog number for AKR1A1 Peptide - middle region is orb1999738.

What sizes are available for AKR1A1 Peptide - middle region?

AKR1A1 Peptide - middle region is available in the following size(s): 100 µg.

Is AKR1A1 Peptide - middle region in stock?

AKR1A1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

AKR1A1 Peptide - middle region

Product Specifications

Product Name Alternative

ALR, ARM, DD3, ALDR1, HEL-S-6

UniProt

P14550

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001189342.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

129994-APC 100 µL

MTSS1 (Metastasis Suppressor Protein 1, Missing In Metastasis Protein, Metastasis Suppressor YGL-1, KIAA0429, MIM) (APC)

Sign In for Pricing

View Details

TA505858 100 µL

LZIC Mouse Monoclonal Antibody [Clone ID: OTI4E6]

Sign In for Pricing

View Details

MBS736457-01 48 Well

Porcine Inhibin Binding Protein ELISA Kit

Sign In for Pricing

View Details

MBS736457-02 96 Well

Porcine Inhibin Binding Protein ELISA Kit

Sign In for Pricing

View Details

MBS736457-03 5x 96 Well

Porcine Inhibin Binding Protein ELISA Kit

Sign In for Pricing

View Details

MBS736457-04 10x 96 Well

Porcine Inhibin Binding Protein ELISA Kit

Sign In for Pricing

View Details