What is the catalog number for RDH8 Peptide - middle region?

The catalog number for RDH8 Peptide - middle region is orb1999737.

What sizes are available for RDH8 Peptide - middle region?

RDH8 Peptide - middle region is available in the following size(s): 100 µg.

Is RDH8 Peptide - middle region in stock?

RDH8 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RDH8 Peptide - middle region

Product Specifications

Product Name Alternative

PRRDH, SDR28C2

UniProt

Q9NYR8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_056540.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTR10461388 96 Well

Rabbit Cathepsin S ELISA kit

Sign In for Pricing

View Details

NB500-473G 0.1 mL

Mouse Monoclonal HIV-1 p24 Antibody (ND1) [DyLight 488]

Sign In for Pricing

View Details

31701154 3x 1.0 µg DNA

NEK11 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing

View Details

E30P01236A 50 µg

Recombinant Human LYAR Protein

Sign In for Pricing

View Details

TA398391 100 µg

H3FA (HIST1H3A) Rabbit Monoclonal Antibody [Clone ID: RM180]

Sign In for Pricing

View Details

M854284010 100 Tests / 1 mL

CD40, B-B20; IgG1; Biotin

Sign In for Pricing

View Details