PDGFC Peptide - N-terminal region
PDGFC Peptide - N-terminal region
Product Specifications
Product Name Alternative
SCDGF, FALLOTEIN
UniProt
Q9NRA1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_057289.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
YLA0198CA-01 48 Tests
Canine Total antioxidant capacity, T-AOC ELISA Kit
Sign In for Pricing
View Details YLA0198CA-02 96 Tests
Canine Total antioxidant capacity, T-AOC ELISA Kit
Sign In for Pricing
View Details 
bs-0295M-BF647 200 µL
Mouse Anti-Rabbit IgG Antibody (H+L), AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details NRB36850-01 250 mg
5-[ (3-Methoxyphenyl) methyl]-1,3,4-oxadiazole-2-thiol
Sign In for Pricing
View Details NRB36850-02 2.5 g
5-[ (3-Methoxyphenyl) methyl]-1,3,4-oxadiazole-2-thiol
Sign In for Pricing
View Details