Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYH Peptide - middle region

PHYH Peptide - middle region

Product Specifications

Product Name Alternative

RD, LN1, PAHX, LNAP1, PHYH1

UniProt

O14832

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006205.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS18 (NM_022551) Human Over-expression Lysate
LS006222 100 µg

RPS18 (NM_022551) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-HSD17B13 (Ser33) Rabbit Polyclonal Antibody (BF350)
orb1813941 100 µL

Phospho-HSD17B13 (Ser33) Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Rimklb Rabbit Polyclonal Antibody
orb326023 100 µL

Rimklb Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DSP (Desmoplakin) BioAssayTM ELISA Kit (Human) discontinued
382699 96 Tests

DSP (Desmoplakin) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
HYI (Putative Hydroxypyruvate Isomerase, Endothelial Cell Apoptosis Protein E-CE1, HT036, SB156, MGC20767) (HRP)
MBS6381940-01 0.1 mL

HYI (Putative Hydroxypyruvate Isomerase, Endothelial Cell Apoptosis Protein E-CE1, HT036, SB156, MGC20767) (HRP)

Sign In for Pricing
View Details
HYI (Putative Hydroxypyruvate Isomerase, Endothelial Cell Apoptosis Protein E-CE1, HT036, SB156, MGC20767) (HRP)
MBS6381940-02 5x 0.1 mL

HYI (Putative Hydroxypyruvate Isomerase, Endothelial Cell Apoptosis Protein E-CE1, HT036, SB156, MGC20767) (HRP)

Sign In for Pricing
View Details