Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA7 Peptide - C-terminal region

PSMA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C6, HSPC, RC6-1, XAPC7, HEL-S-276

UniProt

O14818

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002783.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta 2 (TGFB2) Human Gene Knockout Kit (CRISPR)
KN212624BN 1 Kit

TGF beta 2 (TGFB2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS622662 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope Polyclonal Antibody
E-AB-V1322-01 20 µL

Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope Polyclonal Antibody

Sign In for Pricing
View Details
Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope Polyclonal Antibody
E-AB-V1322-02 100 µL

Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope Polyclonal Antibody

Sign In for Pricing
View Details
cis-Octahydropyrrolo[3,4-b]pyridine
TRC-O236960-500MG 500 mg

cis-Octahydropyrrolo[3,4-b]pyridine

Sign In for Pricing
View Details
TSFM Human Knockdown Lysate
LY300458 100 µg

TSFM Human Knockdown Lysate

Sign In for Pricing
View Details