Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA7 Peptide - C-terminal region

PSMA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C6, HSPC, RC6-1, XAPC7, HEL-S-276

UniProt

O14818

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002783.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2T1 Antibody
8G565-AAT 50 µg

OR2T1 Antibody

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF405S conjugate, 0.1mg/mL
BNC042470-100 1x 100 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EMD Antibody
KC-25920-01 50 μL

EMD Antibody

Sign In for Pricing
View Details
EMD Antibody
KC-25920-02 100 µL

EMD Antibody

Sign In for Pricing
View Details
EMD Antibody
KC-25920-03 1 mL

EMD Antibody

Sign In for Pricing
View Details
Cstdc5 Mouse Gene Knockout Kit (CRISPR)
KN502073 1 Kit

Cstdc5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details