What is the catalog number for UBE4B Peptide - N-terminal region?

The catalog number for UBE4B Peptide - N-terminal region is orb1999729.

What sizes are available for UBE4B Peptide - N-terminal region?

UBE4B Peptide - N-terminal region is available in the following size(s): 100 µg.

Is UBE4B Peptide - N-terminal region in stock?

UBE4B Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

UBE4B Peptide - N-terminal region

Product Specifications

Product Name Alternative

E4, UFD2, HDNB1, UBOX3, UFD2A

UniProt

O95155

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001099032.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSRSQSMDIDGVSCEKSMSQVDVDSGIENMEVDENDRREKRSLSDKEPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV000269 500 ng

ACAD9 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing

View Details

orb3133991-01 10 mg

Topoisomerase I inhibitor 16

Sign In for Pricing

View Details

orb3133991-02 50 mg

Topoisomerase I inhibitor 16

Sign In for Pricing

View Details

LV660744 1.0 µg DNA

ALX1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing

View Details

FPGB235 1 Unit

BeyoGoldTM Polypropylene Graduated Beaker with Handle

Sign In for Pricing

View Details

437686-01 10 mg

6- (BOC-Methylamino) pyridine-3-boronic acid

Sign In for Pricing

View Details