RPL35A Peptide - middle region
RPL35A Peptide - middle region
Product Specifications
Product Name Alternative
DBA5, L35A
UniProt
P18077
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000987.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TR305288 1 Kit
Collagen VI (COL6A2) Human shRNA Plasmid Kit (Locus ID 1292)
Sign In for Pricing
View Details 
52021091 4x 500 ng
01/09/2014-set siRNA/shRNA/RNAi Lentivector (Human)
Sign In for Pricing
View Details P9008-80C 50 µg
Prokineticin 1 (Prokineticin-1, PK1, PRK1, PROK1, Endocrine-gland-derived Vascular Endothelial Growth Factor, EGVEGF, EG-VEGF) (Biotin)
Sign In for Pricing
View Details