What is the catalog number for RPL35A Peptide - middle region?

The catalog number for RPL35A Peptide - middle region is orb1999727.

What sizes are available for RPL35A Peptide - middle region?

RPL35A Peptide - middle region is available in the following size(s): 100 µg.

Is RPL35A Peptide - middle region in stock?

RPL35A Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RPL35A Peptide - middle region

Product Specifications

Product Name Alternative

DBA5, L35A

UniProt

P18077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000987.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-71608AF647 0.1 mL

Mouse Monoclonal AHSA1 Antibody (OTI1D2) [Alexa Fluor 647]

Sign In for Pricing

View Details

RC203476L4 10 µg

VILIP3 (HPCAL1) (NM_134421) Human Tagged Lenti ORF Clone

Sign In for Pricing

View Details

EK713660 96 Well

Human Serpin A9 (SERPINA9) Elisa Kit

Sign In for Pricing

View Details

125753-HRP 100 µL

Decorin (DCN, Bone Proteoglycan II, CSCD, DSPG2, PG40, PGII, PGS2, Small Leucine Rich Protein 1B, SLRR1B) (HRP)

Sign In for Pricing

View Details

D2815-1μg 1 μg

PCMV-GFP-LC3B

Sign In for Pricing

View Details

C19370-01 25 g

Chlorosulfonyl isocyanate 97%

Sign In for Pricing

View Details