Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRA3 Peptide - middle region

GFRA3 Peptide - middle region

Product Specifications

Product Name Alternative

GDNFR3

UniProt

O60609

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001487.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (4-aminophenyl) -3,4-difluorobenzenesulfonamide hydrochloride
sc-354672A 1 g

N- (4-aminophenyl) -3,4-difluorobenzenesulfonamide hydrochloride

Sign In for Pricing
View Details
Rat Txndc16 Pre-designed siRNA Set B
SI215449B 1 Each

Rat Txndc16 Pre-designed siRNA Set B

Sign In for Pricing
View Details
KIF4A Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2394856 100 µL

KIF4A Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Human COQ10A/Coenzyme Q-binding protein COQ10 homolog A, mitochondrial ELISA Kit
E0535Hu 96 Tests

Human COQ10A/Coenzyme Q-binding protein COQ10 homolog A, mitochondrial ELISA Kit

Sign In for Pricing
View Details
SGF29 Human Pre-designed siRNA Set A
HY-RS12796 1 Set

SGF29 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit cTnT ELISA Kit
orb567945-01 48 Tests

Rabbit cTnT ELISA Kit

Sign In for Pricing
View Details