GFRA3 Peptide - middle region
GFRA3 Peptide - middle region
Product Specifications
Product Name Alternative
GDNFR3
UniProt
O60609
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001487.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1438511-01 0.02 mg (E-Coli)
Recombinant Human Growth factor receptor-bound protein 14 (GRB14)
Sign In for Pricing
View Details MBS1438511-02 0.02 mg (Yeast)
Recombinant Human Growth factor receptor-bound protein 14 (GRB14)
Sign In for Pricing
View Details MBS1438511-03 0.1 mg (E-Coli)
Recombinant Human Growth factor receptor-bound protein 14 (GRB14)
Sign In for Pricing
View Details MBS1438511-04 0.1 mg (Yeast)
Recombinant Human Growth factor receptor-bound protein 14 (GRB14)
Sign In for Pricing
View Details MBS1438511-05 0.02 mg (Baculovirus)
Recombinant Human Growth factor receptor-bound protein 14 (GRB14)
Sign In for Pricing
View Details MBS1438511-06 0.02 mg (Mammalian-Cell)
Recombinant Human Growth factor receptor-bound protein 14 (GRB14)
Sign In for Pricing
View Details