GPS1 Peptide - N-terminal region
GPS1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CSN1, COPS1
UniProt
Q13098
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004118.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2125438-01 0.01 mg
Recombinant Fatty Acid Binding Protein 2, Intestinal (FABP2)
Sign In for Pricing
View Details MBS2125438-02 0.05 mg
Recombinant Fatty Acid Binding Protein 2, Intestinal (FABP2)
Sign In for Pricing
View Details MBS2125438-03 0.1 mg
Recombinant Fatty Acid Binding Protein 2, Intestinal (FABP2)
Sign In for Pricing
View Details MBS2125438-04 0.2 mg
Recombinant Fatty Acid Binding Protein 2, Intestinal (FABP2)
Sign In for Pricing
View Details MBS2125438-05 0.5 mg
Recombinant Fatty Acid Binding Protein 2, Intestinal (FABP2)
Sign In for Pricing
View Details