Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPS1 Peptide - N-terminal region

GPS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSN1, COPS1

UniProt

Q13098

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004118.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TAF9 Protein, His, E.coli-5ug
QP13686-5ug 5ug

Recombinant Human TAF9 Protein, His, E.coli-5ug

Sign In for Pricing
View Details
PRKAB1 Rabbit Polyclonal Antibody
orb394704-01 50 µg

PRKAB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRKAB1 Rabbit Polyclonal Antibody
orb394704-02 100 µg

PRKAB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NG2 Rabbit Monoclonal Antibody
AMRe86773-01 1 Each

NG2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NG2 Rabbit Monoclonal Antibody
AMRe86773-02 50 µL

NG2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NG2 Rabbit Monoclonal Antibody
AMRe86773-03 100 µL

NG2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details