Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS2 Peptide - N-terminal region

NDUFS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CI-49

UniProt

O75306

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159631.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRQWQPDVEWAQQFGGAVMYPSKETAHWKPPPWNDVDPPKDTIVKNITLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sytl2 ORF Vector (Mouse) (pORF)
ORF058973 1.0 µg DNA

Sytl2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal Cyclin T1 Antibody [Janelia Fluor 646]
NBP3-06557JF646 0.1 mL

Rabbit Polyclonal Cyclin T1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
LOC684365 3'UTR GFP Stable Cell Line
TU261067 1.0 mL

LOC684365 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ccdc189 (NM_001134694) Rat Tagged Lenti ORF Clone
RR205261L3 10 µg

Ccdc189 (NM_001134694) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ELISA Kit For Putative phospholipase B-like 2
E7379r 96 Tests

ELISA Kit For Putative phospholipase B-like 2

Sign In for Pricing
View Details
C1orf65 CRISPR Knock Out 293T Cell Line (Human)
14218141 1x 10^6 Cells / 1.0 mL

C1orf65 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details