Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM4 Peptide - C-terminal region

LSM4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GRP, YER112W

UniProt

Q9Y4Z0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036453.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB4A Adenovirus (Human)
38352051 1.0 mL

RAB4A Adenovirus (Human)

Sign In for Pricing
View Details
WFDC1 Rabbit pAb
E45R29695N-50 50 µL

WFDC1 Rabbit pAb

Sign In for Pricing
View Details
L.R. White Embedding Media (for European Orders only)
17411S-500 500 mL

L.R. White Embedding Media (for European Orders only)

Sign In for Pricing
View Details
RBPMS Antibody
orb1319401-01 30 µL

RBPMS Antibody

Sign In for Pricing
View Details
RBPMS Antibody
orb1319401-02 50 μL

RBPMS Antibody

Sign In for Pricing
View Details
RBPMS Antibody
orb1319401-03 100 µL

RBPMS Antibody

Sign In for Pricing
View Details