What is the catalog number for CACNA2D3 Peptide - middle region?

The catalog number for CACNA2D3 Peptide - middle region is orb1999719.

What sizes are available for CACNA2D3 Peptide - middle region?

CACNA2D3 Peptide - middle region is available in the following size(s): 100 µg.

Is CACNA2D3 Peptide - middle region in stock?

CACNA2D3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CACNA2D3 Peptide - middle region

Product Specifications

Product Name Alternative

HSA272268

UniProt

Q8IZS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060868.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

abx101731-01 100 µL

Complement Factor B (CFB) Antibody

Sign In for Pricing

View Details

abx101731-02 200 µL

Complement Factor B (CFB) Antibody

Sign In for Pricing

View Details

abx101731-03 1 mL

Complement Factor B (CFB) Antibody

Sign In for Pricing

View Details

PC109588-01 50 mg

2-[3-Chloro-5- (trifluoromethyl) -2-pyridinyl]-N, N-dimethylethenamine

Sign In for Pricing

View Details

PC109588-02 100 mg

2-[3-Chloro-5- (trifluoromethyl) -2-pyridinyl]-N, N-dimethylethenamine

Sign In for Pricing

View Details

PC109588-03 250 mg

2-[3-Chloro-5- (trifluoromethyl) -2-pyridinyl]-N, N-dimethylethenamine

Sign In for Pricing

View Details