CACNA2D3 Peptide - middle region
CACNA2D3 Peptide - middle region
Product Specifications
Product Name Alternative
HSA272268
UniProt
Q8IZS8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060868.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: THPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
YP-W200510-01 48 Tests
Mouse Wingless Type MMTV Integration Site Family, Member 11 (WNT11) ELISA Kit
Sign In for Pricing
View Details YP-W200510-02 96 Tests
Mouse Wingless Type MMTV Integration Site Family, Member 11 (WNT11) ELISA Kit
Sign In for Pricing
View Details 303509 100 µg
P53 (Antigen NY-CO-13, BCC7, Cellular Tumor Antigen p53, Cys 51 Stop, LFS1, Mutant Tumor Protein 53, P53 Cellular Tumor Antigen, P53 Tumor Suppressor, P53_HUMAN, Phosphoprotein P53, Tp53, Transformation Related Protein 53, TRP53, Tumor Protein P53, Tumor Suppressor P53, Tumor Protein p53)
Sign In for Pricing
View Details LV634654 1.0 µg DNA
Olr464 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
Sign In for Pricing
View Details