Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANS Peptide - middle region

NANS Peptide - middle region

Product Specifications

Product Name Alternative

SAS, HEL-S-100

UniProt

Q9NR45

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061819.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Baalc Mouse shRNA Lentiviral Particle (Locus ID 118452)
TL519613V 500 µL Each

Baalc Mouse shRNA Lentiviral Particle (Locus ID 118452)

Sign In for Pricing
View Details
Human BAFFR Protein, His Tag
orb762450-01 1 mg

Human BAFFR Protein, His Tag

Sign In for Pricing
View Details
Human BAFFR Protein, His Tag
orb762450-02 100 µg

Human BAFFR Protein, His Tag

Sign In for Pricing
View Details
Umbilical Cord, Human Donor
MBS170337 Inquire

Umbilical Cord, Human Donor

Sign In for Pricing
View Details
Human Serine/threonine-protein kinase H1 (PSKH1) ELISA Kit
abx385315 96 Tests

Human Serine/threonine-protein kinase H1 (PSKH1) ELISA Kit

Sign In for Pricing
View Details
EAI045 5mg
A16193-5 5 mg

EAI045 5mg

Sign In for Pricing
View Details