NANS Peptide - middle region
NANS Peptide - middle region
Product Specifications
Product Name Alternative
SAS, HEL-S-100
UniProt
Q9NR45
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_061819.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9428551-01 96 Tests
Human G-protein coupled receptor family C group 6 member A, hGPRC6A ELISA Kit
Sign In for Pricing
View Details MBS9428551-02 5x 96 Tests
Human G-protein coupled receptor family C group 6 member A, hGPRC6A ELISA Kit
Sign In for Pricing
View Details 
E40VAG257 20 µg
Influenza A H14N5 (A/mallard/Astrakhan/263/1982) HA protein, His Tag
Sign In for Pricing
View Details