Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PELI1 Peptide - middle region

PELI1 Peptide - middle region

Product Specifications

UniProt

Q96FA3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065702.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP9 Polyclonal Antibody
MBS2547521-01 0.06 mL

CASP9 Polyclonal Antibody

Sign In for Pricing
View Details
CASP9 Polyclonal Antibody
MBS2547521-02 0.12 mL

CASP9 Polyclonal Antibody

Sign In for Pricing
View Details
CASP9 Polyclonal Antibody
MBS2547521-03 0.2 mL

CASP9 Polyclonal Antibody

Sign In for Pricing
View Details
CASP9 Polyclonal Antibody
MBS2547521-04 5x 0.2 mL

CASP9 Polyclonal Antibody

Sign In for Pricing
View Details
KEAP1 Rabbit Polyclonal Antibody (Biotin)
orb2598433 100 µg

KEAP1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
RBM35B Antibody : FITC (OAPB01253-FITC)
OAPB01253-100UG-FITC 0.1 mg

RBM35B Antibody : FITC (OAPB01253-FITC)

Sign In for Pricing
View Details