Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP14 Peptide - C-terminal region

DUSP14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MKP6, MKP-L

UniProt

O95147

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_008957.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDND1 Conjugated Antibody
C35692 100 µL

CLDND1 Conjugated Antibody

Sign In for Pricing
View Details
L-serine dehydratase (h) -PR
sc-96226-PR 10 µM - 20 µL

L-serine dehydratase (h) -PR

Sign In for Pricing
View Details
Recombinant Human NCL Protein, N-His
AP91128 50 µg

Recombinant Human NCL Protein, N-His

Sign In for Pricing
View Details
Twinkle (TWNK) Human shRNA Plasmid Kit (Locus ID 56652)
TR302545 1 Kit

Twinkle (TWNK) Human shRNA Plasmid Kit (Locus ID 56652)

Sign In for Pricing
View Details
Mouse  TNF-A
300-352P-20ug 20 µg

Mouse TNF-A

Sign In for Pricing
View Details
Human FBLN7 Pre-designed siRNA Set A
SI005506A 1 Each

Human FBLN7 Pre-designed siRNA Set A

Sign In for Pricing
View Details