Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP14 Peptide - C-terminal region

DUSP14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MKP6, MKP-L

UniProt

O95147

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_008957.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complete Medium for Rabbit Pulmonary Aorta Smooth Muscle Cells
abx704643-01 100 mL

Complete Medium for Rabbit Pulmonary Aorta Smooth Muscle Cells

Sign In for Pricing
View Details
Complete Medium for Rabbit Pulmonary Aorta Smooth Muscle Cells
abx704643-02 500 mL

Complete Medium for Rabbit Pulmonary Aorta Smooth Muscle Cells

Sign In for Pricing
View Details
Mouse QSOX1 Recombinant Protein
PPT-16703 100 µg

Mouse QSOX1 Recombinant Protein

Sign In for Pricing
View Details
Human IgG whole molecule Biotin conjugated Protein
OPRA03734-1MG 1 mg

Human IgG whole molecule Biotin conjugated Protein

Sign In for Pricing
View Details
KRR1 (NM_007043) Human Tagged Lenti ORF Clone
RC206028L1 10 µg

KRR1 (NM_007043) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MINPP1 (NM_001178117) Human Tagged ORF Clone
RC229866 10 µg

MINPP1 (NM_001178117) Human Tagged ORF Clone

Sign In for Pricing
View Details