Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP2 Peptide - middle region

EIF4EBP2 Peptide - middle region

Product Specifications

Product Name Alternative

4EBP2, PHASII

UniProt

Q13542

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004087.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kv10.1 Antibody
abx009070-01 30 µL

Kv10.1 Antibody

Sign In for Pricing
View Details
Kv10.1 Antibody
abx009070-02 100 µL

Kv10.1 Antibody

Sign In for Pricing
View Details
Kv10.1 Antibody
abx009070-03 200 µL

Kv10.1 Antibody

Sign In for Pricing
View Details
RHC1A Antibody
orb795380 2 mg

RHC1A Antibody

Sign In for Pricing
View Details
Kcnk2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
25399124 3x 1.0µg DNA

Kcnk2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
TIP41-Like protein (TIPRL) Mouse ELISA Kit
H6274 96 Tests

TIP41-Like protein (TIPRL) Mouse ELISA Kit

Sign In for Pricing
View Details