CTNNBL1 Peptide - N-terminal region
CTNNBL1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
NAP, P14L, PP8304, C20orf33, dJ633O20.1
UniProt
Q8WYA6
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_110517.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVEEAD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402624-100 1x 100 µL
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471950-100 1x 100 µL
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471097-500 1x 500 µL
CD44 Standard (HCAM/1097), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details