Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH2R Peptide - C-terminal region

PTH2R Peptide - C-terminal region

Product Specifications

Product Name Alternative

PTHR2

UniProt

P49190

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005039.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human TNFSF13B (TNF superfamily member 13b) for Antibody Discovery
MP1196J Each

Magic™ Membrane Protein Human TNFSF13B (TNF superfamily member 13b) for Antibody Discovery

Sign In for Pricing
View Details
Venetoclax Nitroso Impurity 1
CS-EO-01587 1 Each

Venetoclax Nitroso Impurity 1

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) HIC Polyclonal Antibody
MBS7146036 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) HIC Polyclonal Antibody

Sign In for Pricing
View Details
LAP2 Double Nickase Plasmid (m)
sc-423428-NIC 20 µg

LAP2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
ASTL AAV Vector (Human) (CMV)
12586101 1 µg

ASTL AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Mouse Monoclonal IL-17F Antibody (B-F60) [Alexa Fluor 532]
NBP3-14589AF532 0.1 mL

Mouse Monoclonal IL-17F Antibody (B-F60) [Alexa Fluor 532]

Sign In for Pricing
View Details