PTH2R Peptide - C-terminal region
PTH2R Peptide - C-terminal region
Product Specifications
Product Name Alternative
PTHR2
UniProt
P49190
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_005039.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2905009-01 48 Well
Human PLAC9/Placenta-specific protein 9 ELISA Kit
Sign In for Pricing
View Details MBS2905009-02 96 Well
Human PLAC9/Placenta-specific protein 9 ELISA Kit
Sign In for Pricing
View Details MBS2905009-03 5x 96 Well
Human PLAC9/Placenta-specific protein 9 ELISA Kit
Sign In for Pricing
View Details MBS2905009-04 10x 96 Well
Human PLAC9/Placenta-specific protein 9 ELISA Kit
Sign In for Pricing
View Details