Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP1 Peptide - C-terminal region

TNFAIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B12, B61, EDP1, BTBD34, hBACURD2

UniProt

Q13829

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066960.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferric Phosphate
TRC-F307535-250MG 250 mg

Ferric Phosphate

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
RAB21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G3]
TA505719AM 100 µL

RAB21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G3]

Sign In for Pricing
View Details
PCSK9 Human Gene Knockout Kit (CRISPR)
KN220000 1 Kit

PCSK9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOXA1 / HNF3A (rFOXA1/1515), 1mg/mL
BNUM2305-50 1x 50 µL

FOXA1 / HNF3A (rFOXA1/1515), 1mg/mL

Sign In for Pricing
View Details