Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP1 Peptide - C-terminal region

TNFAIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B12, B61, EDP1, BTBD34, hBACURD2

UniProt

Q13829

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066960.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nprl3 activation kit by CRISPRa
GA202573 1 Kit

Mouse Nprl3 activation kit by CRISPRa

Sign In for Pricing
View Details
ABL2 (NM_001100108) Human Over-expression Lysate
LC420218 20 µg

ABL2 (NM_001100108) Human Over-expression Lysate

Sign In for Pricing
View Details
Rapid Low Temperature Closed Cup Flash Point Tester BPTL-239
BPTL-239 1 Unit

Rapid Low Temperature Closed Cup Flash Point Tester BPTL-239

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF488A conjugate, 0.1mg/mL
BNC882054-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EIF4EBP1 Rabbit Polyclonal Antibody
AP02724PU-N 100 µL

EIF4EBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human BHLHA15 activation kit by CRISPRa
GA116177 1 Kit

Human BHLHA15 activation kit by CRISPRa

Sign In for Pricing
View Details