RAB33A Peptide - middle region
RAB33A Peptide - middle region
Product Specifications
Product Name Alternative
RabS10
UniProt
Q14088
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004785.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKV
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV676289 1.0 µg DNA
BTLA Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details 
029609-PE 100 µL
SIRP alpha (Signal Regulatory Protein alpha, SIRPalpha, SIRPA, SIRP, Signal-regulatory Protein alpha-1, Sirp-alpha-1, Signal-regulatory Protein alpha-2, Sirp-alpha-2, Signal-regulatory Protein alpha-3, Sirp-alpha-3, Brain Ig-like Molecule with Tyrosine-based Activation Motifs, Bit, CD172 Antigen-like Family Member A, CD172a, Inhibitory Receptor SHPS-1, Macrophage Fusion Receptor, MFR, MyD-1 Antigen, MYD1, MYD-1, p84, PTPNS1, SHP Substrate 1, SHPS1, SHPS-1, Tyrosine-protein Phosphatase Non-receptor Type Substrate 1) (PE) discontinued
Sign In for Pricing
View Details NBP2-50599JF646 0.1 mL
Mouse Monoclonal EGFR Antibody (DH8.3) [Janelia Fluor 646] - Mutant
Sign In for Pricing
View Details