Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMO Peptide - middle region

TRMO Peptide - middle region

Product Specifications

Product Name Alternative

NAP1, HSPC219, C9orf156

UniProt

Q9BU70

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057565.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin Protein P0 (FITC)
324853-01 50 µg

Myelin Protein P0 (FITC)

Sign In for Pricing
View Details
Myelin Protein P0 (FITC)
324853-02 100 µg

Myelin Protein P0 (FITC)

Sign In for Pricing
View Details
Chordin Polyclonal Antibody
MBS8595381-01 0.1 mg

Chordin Polyclonal Antibody

Sign In for Pricing
View Details
Chordin Polyclonal Antibody
MBS8595381-02 0.1 mL (AF405L)

Chordin Polyclonal Antibody

Sign In for Pricing
View Details
Chordin Polyclonal Antibody
MBS8595381-03 0.1 mL (AF405S)

Chordin Polyclonal Antibody

Sign In for Pricing
View Details
Chordin Polyclonal Antibody
MBS8595381-04 0.1 mL (AF610)

Chordin Polyclonal Antibody

Sign In for Pricing
View Details