DNAJA4 Peptide - N-terminal region
DNAJA4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MST104, MSTP104, PRO1472
UniProt
Q8WW22
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001123654.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISQAYEVLSDPKKRDVYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFGGGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP73936_P050-Biotin 100 µL
COX5B Antibody - middle region : Biotin (ARP73936_P050-Biotin)
Sign In for Pricing
View Details 
MBS1103241-01 0.02 mg (E-Coli)
Recombinant Streptococcus gordonii tRNA (Ile)-lysidine synthase
Sign In for Pricing
View Details MBS1103241-02 0.02 mg (Yeast)
Recombinant Streptococcus gordonii tRNA (Ile)-lysidine synthase
Sign In for Pricing
View Details MBS1103241-03 0.1 mg (E-Coli)
Recombinant Streptococcus gordonii tRNA (Ile)-lysidine synthase
Sign In for Pricing
View Details