DNAJA4 Peptide - N-terminal region
DNAJA4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MST104, MSTP104, PRO1472
UniProt
Q8WW22
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001123654.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISQAYEVLSDPKKRDVYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFGGGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
JOT-EK0015HO-01 96 Well
Horse Vascular Endothelial cell Growth Factor,VEGF ELISA KIT
Sign In for Pricing
View Details JOT-EK0015HO-02 48 Well
Horse Vascular Endothelial cell Growth Factor,VEGF ELISA KIT
Sign In for Pricing
View Details 458075-01 50 mg
N-Allyl-3-chloro-10,11-dihydro-5H-dibenzo[b, f]azepine
Sign In for Pricing
View Details 458075-02 500 mg
N-Allyl-3-chloro-10,11-dihydro-5H-dibenzo[b, f]azepine
Sign In for Pricing
View Details 