Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDEM2 Peptide - N-terminal region

EDEM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C20orf31, C20orf49, bA4204.1

UniProt

Q9BV94

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138497.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLLCALLPQHHGAPGPDGSAPDPAHYRERVKAMFYHAYDSYLENAFPFDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL34 (NM_033625) Human Recombinant Protein
TP761207 50 µg

RPL34 (NM_033625) Human Recombinant Protein

Sign In for Pricing
View Details
NT5DC2 Rabbit Polyclonal Antibody
TA361819 100 µL

NT5DC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF446 antibody
FNab09700 100 µg

ZNF446 antibody

Sign In for Pricing
View Details
Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8A9]
TA802692BM 100 µL

Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8A9]

Sign In for Pricing
View Details
Human KLC4 activation kit by CRISPRa
GA113964 1 Kit

Human KLC4 activation kit by CRISPRa

Sign In for Pricing
View Details
Suvorexant
TRC-S870000-5MG 5 mg

Suvorexant

Sign In for Pricing
View Details