Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDEM2 Peptide - N-terminal region

EDEM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C20orf31, C20orf49, bA4204.1

UniProt

Q9BV94

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138497.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLLCALLPQHHGAPGPDGSAPDPAHYRERVKAMFYHAYDSYLENAFPFDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, Basic (Type II or HMW) (KRTH/2147R), Biotin conjugate, 0.1mg/mL
BNCB2147-100 1x 100 µL

Cytokeratin, Basic (Type II or HMW) (KRTH/2147R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KDM5B Human Gene Knockout Kit (CRISPR)
KN414918 1 Kit

KDM5B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD40 Recombinant Rabbit monoclonal Antibody
HA723170 100 µL

CD40 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), CF647 conjugate, 0.1mg/mL
BNC470708-500 1x 500 µL

Kappa Light Chain (TB28-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABCB5 Antibody
KC-26530-01 50 μL

ABCB5 Antibody

Sign In for Pricing
View Details
ABCB5 Antibody
KC-26530-02 100 µL

ABCB5 Antibody

Sign In for Pricing
View Details