PTPA Peptide - N-terminal region
PTPA Peptide - N-terminal region
Product Specifications
Product Name Alternative
PP2A, PR53, PPP2R4
UniProt
Q15257
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001180326.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400003-100 1x 100 µL
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740630-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880029-100 1x 100 µL
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 