Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB9 Peptide - N-terminal region

ASB9 Peptide - N-terminal region

Product Specifications

UniProt

Q96DX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001026909.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Screw-cap MicroCentrifuge Tubes
C3172 1000 Units/Case

Screw-cap MicroCentrifuge Tubes

Sign In for Pricing
View Details
CD47 (IAP/964), CF488A conjugate, 0.1mg/mL
BNC880964-500 1x 500 µL

CD47 (IAP/964), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzofuran
TRC-B203580-5G 5 g

Benzofuran

Sign In for Pricing
View Details
DDX4 (NM_001166534) Human Over-expression Lysate
LY433297 100 µg

DDX4 (NM_001166534) Human Over-expression Lysate

Sign In for Pricing
View Details
RTN4RL2 Antibody
KC-3753-01 50 μL

RTN4RL2 Antibody

Sign In for Pricing
View Details
RTN4RL2 Antibody
KC-3753-02 100 µL

RTN4RL2 Antibody

Sign In for Pricing
View Details