Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCOCO2 Peptide - middle region

CALCOCO2 Peptide - middle region

Product Specifications

Product Name Alternative

NDP52

UniProt

Q13137

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001248319.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Frexalimab
HB199056-01 5 mg

Research Grade Frexalimab

Sign In for Pricing
View Details
Research Grade Frexalimab
HB199056-02 10 mg

Research Grade Frexalimab

Sign In for Pricing
View Details
Research Grade Frexalimab
HB199056-03 25 mg

Research Grade Frexalimab

Sign In for Pricing
View Details
Research Grade Frexalimab
HB199056-04 50 mg

Research Grade Frexalimab

Sign In for Pricing
View Details
Research Grade Frexalimab
HB199056-05 100 mg

Research Grade Frexalimab

Sign In for Pricing
View Details
N-terminal Arginylation Antibody, Clone 11G1: HRP
MBS808425-01 0.1 mg

N-terminal Arginylation Antibody, Clone 11G1: HRP

Sign In for Pricing
View Details