Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN14 Peptide - middle region

PTPN14 Peptide - middle region

Product Specifications

Product Name Alternative

PEZ, PTP36

UniProt

Q15678

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005392.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTPELANMQLQGSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMBRA1 Antibody: PerCP
SPC-644D-PCP 100 µg

AMBRA1 Antibody: PerCP

Sign In for Pricing
View Details
Aquaporin 3 Recombinant Rabbit monoclonal Antibody
HA751081 100 µL

Aquaporin 3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human PCDHA10 activation kit by CRISPRa
GA111131 1 Kit

Human PCDHA10 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS635342 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
SNAIL (SNAI1) Mouse Monoclonal Antibody [Clone ID: 6D2]
AM06589SU-N 100 µL

SNAIL (SNAI1) Mouse Monoclonal Antibody [Clone ID: 6D2]

Sign In for Pricing
View Details
IFI16 Antibody
KC-3772-01 50 μL

IFI16 Antibody

Sign In for Pricing
View Details