Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCC1 Peptide - C-terminal region

UQCC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BFZB, CBP3, UQCC, C20orf44

UniProt

Q9NVA1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171906.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSPTYNDEGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGN46 (TGOLN2) (NM_006464) Human Recombinant Protein
TP303323 20 µg

TGN46 (TGOLN2) (NM_006464) Human Recombinant Protein

Sign In for Pricing
View Details
CRLF3 Antibody
KC-35801-01 50 μL

CRLF3 Antibody

Sign In for Pricing
View Details
CRLF3 Antibody
KC-35801-02 100 µL

CRLF3 Antibody

Sign In for Pricing
View Details
CRLF3 Antibody
KC-35801-03 1 mL

CRLF3 Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108R-01 50 Tests

Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108R-02 100 Tests

Elab Fluor® Violet 500 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details