Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCC1 Peptide - C-terminal region

UQCC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BFZB, CBP3, UQCC, C20orf44

UniProt

Q9NVA1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171906.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSPTYNDEGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apo-M Recombinant Rabbit Monoclonal Antibody [JE37-03]
HA722333 100 µL

Apo-M Recombinant Rabbit Monoclonal Antibody [JE37-03]

Sign In for Pricing
View Details
Nucleolin (364-5 + NCL/902), Biotin conjugate, 0.1mg/mL
BNCB1205-100 1x 100 µL

Nucleolin (364-5 + NCL/902), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aurora-A Antibody
OC-155-01 50 μL

Aurora-A Antibody

Sign In for Pricing
View Details
Aurora-A Antibody
OC-155-02 100 µL

Aurora-A Antibody

Sign In for Pricing
View Details
Aurora-A Antibody
OC-155-03 1 mL

Aurora-A Antibody

Sign In for Pricing
View Details
Docosanedioic Acid
TRC-D678845-1G 1 g

Docosanedioic Acid

Sign In for Pricing
View Details