Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3D1 Peptide - middle region

AP3D1 Peptide - middle region

Product Specifications

Product Name Alternative

ADTD, hBLVR

UniProt

O14617

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001248755.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSSLPTESDEDIAPAQQVDIVTEEMPENALPSDEDDKDPNDPYRALDIDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-17F Recombinant Rabbit monoclonal Antibody
HA723903 100 µL

Mouse IL-17F Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Buccutite™ Rapid APC-iFluor® 700 Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*
5413-AAT 2 Labelings

Buccutite™ Rapid APC-iFluor® 700 Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*

Sign In for Pricing
View Details
Kir2.1 (KCNJ2) Rabbit Polyclonal Antibody
TA368661 100 µL

Kir2.1 (KCNJ2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alpha-L-Fucosidase Microplate Assay Kit
RDSM186 100 Assays

Alpha-L-Fucosidase Microplate Assay Kit

Sign In for Pricing
View Details
(S)-2-((S)-2-Amino-4-carboxybutanamido)pentanedioic Acid
TRC-A790273-50MG 50 mg

(S)-2-((S)-2-Amino-4-carboxybutanamido)pentanedioic Acid

Sign In for Pricing
View Details
Recombinant Human DTD1 Protein (His Tag)
PKSH032363-01 10 µg

Recombinant Human DTD1 Protein (His Tag)

Sign In for Pricing
View Details