Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGAP3 Peptide - middle region

ARFGAP3 Peptide - middle region

Product Specifications

Product Name Alternative

ARFGAP1

UniProt

Q9NP61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135765.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSSYFDEPVELRSSSFSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR2A Antibody (HRP)
orb24590-01 50 µg

HTR2A Antibody (HRP)

Sign In for Pricing
View Details
HTR2A Antibody (HRP)
orb24590-02 100 µg

HTR2A Antibody (HRP)

Sign In for Pricing
View Details
Nrg1 Mouse Pre-designed siRNA Set A
HY-RS16611 1 Set

Nrg1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
TRPV2 Rabbit Polyclonal Antibody (BF405)
orb2553367 100 µL

TRPV2 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
PGK1P1-set siRNA/shRNA/RNAi Lentivector (Human)
36502091 4x 500 ng

PGK1P1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal ETHE1 Antibody (081)
NBP2-90301-50ul 50 µL

Rabbit Monoclonal ETHE1 Antibody (081)

Sign In for Pricing
View Details