ARFGAP3 Peptide - middle region
ARFGAP3 Peptide - middle region
Product Specifications
Product Name Alternative
ARFGAP1
UniProt
Q9NP61
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001135765.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSSYFDEPVELRSSSFSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
500191 10 µg
JAK3, Recombinant, Human, GST-Tag (Janus kinase 3, Tyrosine-Protein Kinase Jak3, JAKL, LJAK, JAK-3, L-JAK, JAK3-HUMAN) discontinued
Sign In for Pricing
View Details 
TRI-C74M1B 100T
MagaBio plus General Genomic DNA Purification Kit II
Sign In for Pricing
View Details GTR10430983 96 Well
Monkey Olfactory receptor 2M2 (OR2M2) ELISA kit
Sign In for Pricing
View Details 
036528-ML405 100 µL
HFE2, CT (HFE2, HJV, RGMC, Hemojuvelin, Hemochromatosis type 2 protein, RGM domain family member C) (MaxLight 405) discontinued
Sign In for Pricing
View Details MBS6174597-01 0.1 mL
FAM100A (Family with Sequence Similarity 100, Member A, FLJ31223, FLJ32185, PP11303) (Biotin)
Sign In for Pricing
View Details