Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLC2 Peptide - middle region

KLC2 Peptide - middle region

Product Specifications

UniProt

Q9H0B6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128246.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAAHTLEDCASRNRKQGLDPASQTKVVELLKDGSGRRGDRRSSRDMAGGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TMEM132D Antibody
MBS8308427-01 0.03 mL

Anti-TMEM132D Antibody

Sign In for Pricing
View Details
Anti-TMEM132D Antibody
MBS8308427-02 0.05 mL

Anti-TMEM132D Antibody

Sign In for Pricing
View Details
Anti-TMEM132D Antibody
MBS8308427-03 0.1 mL

Anti-TMEM132D Antibody

Sign In for Pricing
View Details
Anti-TMEM132D Antibody
MBS8308427-04 0.2 mL

Anti-TMEM132D Antibody

Sign In for Pricing
View Details
Anti-TMEM132D Antibody
MBS8308427-05 5x 0.2 mL

Anti-TMEM132D Antibody

Sign In for Pricing
View Details
Sodium 4-Decylbenzenesulfonate
TRC-S622000-100MG 100 mg

Sodium 4-Decylbenzenesulfonate

Sign In for Pricing
View Details