Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLC2 Peptide - middle region

KLC2 Peptide - middle region

Product Specifications

UniProt

Q9H0B6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128246.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAAHTLEDCASRNRKQGLDPASQTKVVELLKDGSGRRGDRRSSRDMAGGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHD3 Rabbit Polyclonal Antibody
E10G12365 100 µL

CHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PINK1 Polyclonal Antibody, PE Conjugated
bs-22173R-PE 100 µL

PINK1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Sos 2 (B-6) FITC
sc-393667 FITC 200 µg/mL

Sos 2 (B-6) FITC

Sign In for Pricing
View Details
Cat Semaphorin-4D ELISA Kit
MBS092378 Inquire

Cat Semaphorin-4D ELISA Kit

Sign In for Pricing
View Details
NGD 94-1
T23066-01 1 mg

NGD 94-1

Sign In for Pricing
View Details
NGD 94-1
T23066-02 5 mg

NGD 94-1

Sign In for Pricing
View Details