Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIPEP Peptide - middle region

MIPEP Peptide - middle region

Product Specifications

Product Name Alternative

MIP, HMIP

UniProt

Q99797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005923.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNPQNSEVMPWDPPYYSGVIRAERYNIEPSLYCPFFSLGACMEGLNILLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: left
CS804049 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB524143 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
SYNRG Human Gene Knockout Kit (CRISPR)
KN424534 1 Kit

SYNRG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS641892 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Vitamin B12-O5'-NHS Ester
TRC-V675670-5MG 5 mg

Vitamin B12-O5'-NHS Ester

Sign In for Pricing
View Details
MAP4 (Ab-696) Antibody
8B1092-AAT 50 µg

MAP4 (Ab-696) Antibody

Sign In for Pricing
View Details