Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPBWR2 Peptide - N-terminal region

NPBWR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPR8

UniProt

P48146

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005277.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVILRAPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Carnitine-d9
TRC-L184111-5MG 5 mg

L-Carnitine-d9

Sign In for Pricing
View Details
PGP9.5 (UCHL1) (NM_004181) Human Recombinant Protein
TP720165 10 µg

PGP9.5 (UCHL1) (NM_004181) Human Recombinant Protein

Sign In for Pricing
View Details
4-Chloro-3-nitro-5-sulfamoylbenzoic Acid Ammonium Salt
TRC-C369581-500MG 500 mg

4-Chloro-3-nitro-5-sulfamoylbenzoic Acid Ammonium Salt

Sign In for Pricing
View Details
p-Nitrophenyl 2-Acetamido-2-deoxy-4-O-(Beta-D-galactopyranosyl)-Alpha-D-glucopyranoside
TRC-N501250-5MG 5 mg

p-Nitrophenyl 2-Acetamido-2-deoxy-4-O-(Beta-D-galactopyranosyl)-Alpha-D-glucopyranoside

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (F1G4), CF568 conjugate, 0.1mg/mL
BNC680767-100 1x 100 µL

GnRH-Receptor (LHRH Receptor) (F1G4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmoglein 3 (DSG3) (N-term) Rabbit Polyclonal Antibody
AP51324PU-N 400 µL

Desmoglein 3 (DSG3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details