Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPBWR2 Peptide - N-terminal region

NPBWR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPR8

UniProt

P48146

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005277.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVILRAPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPA Polyclonal Antibody
E-AB-18495-01 20 µL

SNRPA Polyclonal Antibody

Sign In for Pricing
View Details
SNRPA Polyclonal Antibody
E-AB-18495-02 60 µL

SNRPA Polyclonal Antibody

Sign In for Pricing
View Details
SNRPA Polyclonal Antibody
E-AB-18495-03 120 µL

SNRPA Polyclonal Antibody

Sign In for Pricing
View Details
SNRPA Polyclonal Antibody
E-AB-18495-04 200 µL

SNRPA Polyclonal Antibody

Sign In for Pricing
View Details
ST14 Human Gene Knockout Kit (CRISPR)
KN207136 1 Kit

ST14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human NUDT2/Ap4A hydrolase Protein (His Tag)
PKSH030819 100 µg

Recombinant Human NUDT2/Ap4A hydrolase Protein (His Tag)

Sign In for Pricing
View Details