PIH1D1 Peptide - middle region
PIH1D1 Peptide - middle region
Product Specifications
Product Name Alternative
NOP17
UniProt
Q9NWS0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060386.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGRAESGPEKPHLNLWLE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC209669L3V 200 µL
B3GNT3 (NM_014256) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS9319630-01 48 Well
Human 5-aminolevulinate synthase, nonspecific, mitochondrial, ALAS1 ELISA Kit
Sign In for Pricing
View Details MBS9319630-02 96 Well
Human 5-aminolevulinate synthase, nonspecific, mitochondrial, ALAS1 ELISA Kit
Sign In for Pricing
View Details MBS9319630-03 5x 96 Well
Human 5-aminolevulinate synthase, nonspecific, mitochondrial, ALAS1 ELISA Kit
Sign In for Pricing
View Details MBS9319630-04 10x 96 Well
Human 5-aminolevulinate synthase, nonspecific, mitochondrial, ALAS1 ELISA Kit
Sign In for Pricing
View Details 