Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIH1D1 Peptide - middle region

PIH1D1 Peptide - middle region

Product Specifications

Product Name Alternative

NOP17

UniProt

Q9NWS0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060386.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGRAESGPEKPHLNLWLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CEACAM5/CD66e Antibody (COL-1) - IHC-Prediluted
NBP3-05768 7 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (COL-1) - IHC-Prediluted

Sign In for Pricing
View Details
Mouse Monoclonal Cytochrome P450 2E1 Antibody (M12P4H2)
NBP3-07825-20ug 20 µg

Mouse Monoclonal Cytochrome P450 2E1 Antibody (M12P4H2)

Sign In for Pricing
View Details
Guinea Pig Secreted Frizzled Related Protein 4 ELISA Kit
GTR10341051 96 Well

Guinea Pig Secreted Frizzled Related Protein 4 ELISA Kit

Sign In for Pricing
View Details
CPNE6 Rabbit pAb (APR20935N)
APR20935N-01 50 µL

CPNE6 Rabbit pAb (APR20935N)

Sign In for Pricing
View Details
CPNE6 Rabbit pAb (APR20935N)
APR20935N-02 100 µL

CPNE6 Rabbit pAb (APR20935N)

Sign In for Pricing
View Details
CPNE6 Rabbit pAb (APR20935N)
APR20935N-03 200 µL

CPNE6 Rabbit pAb (APR20935N)

Sign In for Pricing
View Details